PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do008907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 198aa    MW: 21843 Da    PI: 5.8759
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do008907.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA436.3e-142864135
        GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                C  Cg +   Tp++Rrgp+g +tLCnaCG+ ++k ++
  Do008907.1 28 CLRCGISAnaTPHMRRGPEGRRTLCNACGIAWAKGKM 64
                5567766667***********************9875 PP

2FAR140.96.6e-1398143147
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47 
                 +fYn+YA ++GFsvrks+s ks +n  + +rtfvCs+eg+r   +++
  Do008907.1  98 EFYNRYAGHLGFSVRKSSSDKSAENI-TRSRTFVCSREGFRPFIDHQ 143
                 6*********************6665.99***********9866665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.4E-62274IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-102273No hitNo description
Gene3DG3DSA:3.30.50.101.1E-112765IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.9E-112962IPR000679Zinc finger, GATA-type
CDDcd002022.54E-73865No hitNo description
PfamPF031014.6E-1098149IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MQFDDDRDIG AAGGNGEVDD KVDEPARCLR CGISANATPH MRRGPEGRRT LCNACGIAWA  60
KGKMRKVIDS DAHIDDATVA KMVPEVGMEF DDEDKAYEFY NRYAGHLGFS VRKSSSDKSA  120
ENITRSRTFV CSREGFRPFI DHQQMQINNQ PNHDSSLSNF HQQGPHGDAQ GNQGYTPLAG  180
IQPQQFIGNF ELNSGAGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985480.12e-85PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_004985481.12e-85PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLA0A0P0VU102e-72A0A0P0VU10_ORYSJ; Os03g0181600 protein (Fragment)
TrEMBLB8APN84e-72B8APN8_ORYSI; Putative uncharacterized protein
TrEMBLW5ELL72e-71W5ELL7_WHEAT; Uncharacterized protein
STRINGBGIOSGA011986-PA1e-71(Oryza sativa Indica Group)
STRINGORGLA03G0057700.18e-70(Oryza glaberrima)
STRINGLOC_Os03g08370.19e-70(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150391318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24470.38e-13GATA-type zinc finger protein with TIFY domain